PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540132.1_FGP004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 114aa    MW: 11969.8 Da    PI: 9.7249
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540132.1_FGP004genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.33.2e-097481255
                       HHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                HLH 12 RRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                       RR+ri +++  L+el+P+a  ++    +Ka++L + ++Y+k Lq
  KN540132.1_FGP004  7 RRERIAERMKALQELVPNA--NKLMQTDKASMLDEIIDYVKFLQ 48
                       9*****************7..48888*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.627147IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.3E-7653IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.49E-12759IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-6748IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000836.04E-10752No hitNo description
Gene3DG3DSA:4.10.280.102.8E-12853IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MRGGGLRRER IAERMKALQE LVPNANKLMQ TDKASMLDEI IDYVKFLQLQ VKASTYTKLL  60
IHVLSMSRLG GAGAVAPLVA DMSSEGRGGG AANGGAPAAA GSDSLTVTEQ QLVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057842e-48AP005784.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0014G10.
GenBankAP0149652e-48AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126172e-48CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610784.11e-40PREDICTED: transcription factor UNE12 isoform X1
SwissprotQ9ZUG96e-31BH066_ARATH; Transcription factor bHLH66
TrEMBLQ6EPZ64e-66Q6EPZ6_ORYSJ; BHLH transcription factor PTF1-like protein
STRINGLOC_Os09g25040.11e-65(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141937118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24260.12e-24LJRHL1-like 1